PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001730.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 350aa    MW: 39410.2 Da    PI: 4.929
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001730.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK70.91.7e-22257306352
                   RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               +++l+d + y +lpi++AA+ +++c+Tv+K+iCR+ G+ RWP+Rki+s+
  Itr_sc001730.1_g00006.1 257 GKLRLKDFAGYLHLPIEEAARRMNICPTVMKKICRRDGLLRWPYRKIRSI 306
                              68999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.108246328IPR003035RWP-RK domain
PfamPF020427.0E-20259306IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MADPSATLGS AFFPYYDHHH PFDHHLPFDQ IPFFSPPELE TTTLQPQSDF SFDGGDYADN  60
NIVCPSHLLE DPVVSTTFGE VKDVPQVWSD VENPTPISAW PPAMASICNN SCQVLREITH  120
TNGLYIWRLE IHGGLGMIAH VVLEKCSLDF SSQNPEYQTF DFSQESMSAV KQFLVGYFED  180
RKREGYVVLE DPLWEFYEAL SVGHGGGEHM DIDTFFQLPP TTHSGNYNEE AEIGGGGGGV  240
EVKAQKIPLS AQRERTGKLR LKDFAGYLHL PIEEAARRMN ICPTVMKKIC RRDGLLRWPY  300
RKIRSIHGKI SNRSKTLSAG NLDAQERERA QADILDLQQQ LATISEAFFD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771409.11e-106PREDICTED: uncharacterized protein LOC104221948
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-10RWP-RK domain-containing protein